SCOPe 2.05: Domain d4muvb_: 4muv B:

Lineage for d4muvb_ (4muv B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein automated matches [190352] (8 species)
   not a true protein

7. Species Mesorhizobium loti [TaxId:266835] [257109] (1 PDB entry)

8. Domain d4muvb_: 4muv B: [257965]
   automated match to d2k0ga_
   complexed with na, pcg; mutant

Details for d4muvb_

PDB Entry: 4muv, 1.25 Å

PDB Description: M. loti cyclic-nucleotide binding domain mutant displaying inverted ligand selectivity, cyclic-GMP bound

PDB Compounds: (B:) Cyclic nucleotide-gated potassium channel mll3241

SCOPe Domain Sequences for d4muvb_:

Sequence; same for both SEQRES and ATOM records:

>d4muvb_ b.82.3.2 (B:) automated matches {Mesorhizobium loti [TaxId: 266835]}
qevrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffv
vegsvsvaspnpselgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcsssp
eiaeifrktalerrgadas

Timeline for d4muvb_:

• d4muvb_ first appeared in SCOPe 2.04
  
• d4muvb_ appears in SCOPe 2.06
  
• d4muvb_ appears in the current release, SCOPe 2.08