Class b: All beta proteins [48724] (176 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
Protein automated matches [190352] (8 species) not a true protein |
Species Mesorhizobium loti [TaxId:266835] [257109] (1 PDB entry) |
Domain d4muvb_: 4muv B: [257965] automated match to d2k0ga_ complexed with na, pcg; mutant |
PDB Entry: 4muv (more details), 1.25 Å
SCOPe Domain Sequences for d4muvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4muvb_ b.82.3.2 (B:) automated matches {Mesorhizobium loti [TaxId: 266835]} qevrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffv vegsvsvaspnpselgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcsssp eiaeifrktalerrgadas
Timeline for d4muvb_: