SCOPe 2.08: Domain d4mxub_: 4mxu B:

Lineage for d4mxub_ (4mxu B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.7: AstE/AspA-like [142526] (3 proteins)
   Pfam PF04952; Succinylglutamate desuccinylase / Aspartoacylase family; contains extra C-terminal domain, new variant of the Barrel-sandwich hybrid fold (51229)

6. Protein automated matches [190870] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [257960] (3 PDB entries)

8. Domain d4mxub_: 4mxu B: [257963]
   automated match to d2gu2a1
   complexed with as9, zn; mutant

Details for d4mxub_

PDB Entry: 4mxu, 2.6 Å

PDB Description: human brain aspartoacylase mutant k213e complex with intermediate analog (n-phosphonomethyl-l-aspartate)

PDB Compounds: (B:) Aspartoacylase

SCOPe Domain Sequences for d4mxub_:

Sequence; same for both SEQRES and ATOM records:

>d4mxub_ c.56.5.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hiqkvaifggthgneltgvflvkhwlengaeiqrtglevkpfitnpravkkctryidcdl
nrifdlenlgkkmsedlpyevrraqeinhlfgpkdsedsydiifdlhnttsnmgctlile
dsrnnfliqmfhyiktslaplpcyvyliehpslkyattrsiakypvgievgpqpqgvlra
dildqmrkmikhaldfihhfnegeefppcaievykiiekvdyprdengeiaaiihpnlqd
qdwkplhpgdpmfltldgktiplggdctvypvfvneaayyekkeafakttkltlnaksir
c

Timeline for d4mxub_:

• d4mxub_ first appeared in SCOPe 2.04
  
• d4mxub_ appears in SCOPe 2.07