SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d8lpra_ (8lpr A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055631Family b.47.1.1: Prokaryotic proteases [50495] (16 protein domains)
  6. 2055637Protein alpha-Lytic protease [50498] (1 species)
  7. 2055638Species Lysobacter enzymogenes, 495 [TaxId:69] [50499] (45 PDB entries)
  8. 2055678Domain d8lpra_: 8lpr A: [25796]
    complexed with so4; mutant

Details for d8lpra_

PDB Entry: 8lpr (more details), 2.25 Å

PDB Description: structural basis for broad specificity in alpha-lytic protease mutants
PDB Compounds: (A:) alpha-lytic protease

SCOPe Domain Sequences for d8lpra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d8lpra_ b.47.1.1 (A:) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]}
anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt
anyaegavrgltqgnacmgrgdsggswitsagqaqgvasggnvqsngnncgipasqrssl
ferlqpilsqyglslvtg

SCOPe Domain Coordinates for d8lpra_:

Click to download the PDB-style file with coordinates for d8lpra_.
(The format of our PDB-style files is described here.)

Timeline for d8lpra_: