Class a: All alpha proteins [46456] (285 folds) |
Fold a.21: HMG-box [47094] (1 superfamily) 3 helices; irregular array |
Superfamily a.21.1: HMG-box [47095] (2 families) |
Family a.21.1.0: automated matches [191668] (1 protein) not a true family |
Protein automated matches [191268] (4 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [257957] (1 PDB entry) |
Domain d2mrca_: 2mrc A: [257958] automated match to d1j3ca_ |
PDB Entry: 2mrc (more details)
SCOPe Domain Sequences for d2mrca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mrca_ a.21.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]} mahhhhhhmkkkdplapkralsaymfyvkdkrleiikekpelakdvaqvgkligeawgql spaqkapyekkaqldkvryskeieeyrkknqe
Timeline for d2mrca_: