Lineage for d2mrca_ (2mrc A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1482507Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 1482508Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 1482584Family a.21.1.0: automated matches [191668] (1 protein)
    not a true family
  6. 1482585Protein automated matches [191268] (4 species)
    not a true protein
  7. 1482595Species Plasmodium falciparum [TaxId:36329] [257957] (1 PDB entry)
  8. 1482596Domain d2mrca_: 2mrc A: [257958]
    automated match to d1j3ca_

Details for d2mrca_

PDB Entry: 2mrc (more details)

PDB Description: nmr structure and 1h, 13c and 15n chemical shift assignments for high mobility group protein from plasmodium falciparum 3d7.
PDB Compounds: (A:) high mobility group protein

SCOPe Domain Sequences for d2mrca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mrca_ a.21.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mahhhhhhmkkkdplapkralsaymfyvkdkrleiikekpelakdvaqvgkligeawgql
spaqkapyekkaqldkvryskeieeyrkknqe

SCOPe Domain Coordinates for d2mrca_:

Click to download the PDB-style file with coordinates for d2mrca_.
(The format of our PDB-style files is described here.)

Timeline for d2mrca_: