SCOPe 2.06: Domain d2mq3a1: 2mq3 A:453-543

Lineage for d2mq3a1 (2mq3 A:453-543)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d2mq3a1: 2mq3 A:453-543 [257956]
   Other proteins in same PDB: d2mq3a2
   automated match to d2edka_
   mutant

Details for d2mq3a1

PDB Entry: 2mq3

PDB Description: NMR structure of the c3 domain of human cardiac myosin binding protein-c with a hypertrophic cardiomyopathy-related mutation R502W.

PDB Compounds: (A:) Myosin-binding protein C, cardiac-type

SCOPe Domain Sequences for d2mq3a1:

Sequence; same for both SEQRES and ATOM records:

>d2mq3a1 b.1.1.0 (A:453-543) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvlitrpledqlvmvgqrvefecevseegaqvkwlkdgveltreetfkywfkkdgqrhhl
iineamledaghyalctsggqalaelivqek

Timeline for d2mq3a1:

• d2mq3a1 first appeared in SCOPe 2.04, called d2mq3a_
  
• d2mq3a1 was called d2mq3a_ in SCOPe 2.05
  
• d2mq3a1 appears in SCOPe 2.07
  
• d2mq3a1 appears in the current release, SCOPe 2.08