SCOPe 2.04: Domain d2mq3a_: 2mq3 A:

Lineage for d2mq3a_ (2mq3 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d2mq3a_: 2mq3 A: [257956]
   automated match to d2edka_
   mutant

Details for d2mq3a_

PDB Entry: 2mq3

PDB Description: NMR structure of the c3 domain of human cardiac myosin binding protein-c with a hypertrophic cardiomyopathy-related mutation R502W.

PDB Compounds: (A:) Myosin-binding protein C, cardiac-type

SCOPe Domain Sequences for d2mq3a_:

Sequence; same for both SEQRES and ATOM records:

>d2mq3a_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshmpvlitrpledqlvmvgqrvefecevseegaqvkwlkdgveltreetfkywfkkdgq
rhhliineamledaghyalctsggqalaelivqek

Timeline for d2mq3a_:

• d2mq3a_ is new in SCOPe 2.04-stable
  
• d2mq3a_ appears in SCOPe 2.05
  
• d2mq3a_ appears in the current release, SCOPe 2.08, called d2mq3a1