Lineage for d2mq3a_ (2mq3 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1520418Domain d2mq3a_: 2mq3 A: [257956]
    automated match to d2edka_
    mutant

Details for d2mq3a_

PDB Entry: 2mq3 (more details)

PDB Description: NMR structure of the c3 domain of human cardiac myosin binding protein-c with a hypertrophic cardiomyopathy-related mutation R502W.
PDB Compounds: (A:) Myosin-binding protein C, cardiac-type

SCOPe Domain Sequences for d2mq3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mq3a_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshmpvlitrpledqlvmvgqrvefecevseegaqvkwlkdgveltreetfkywfkkdgq
rhhliineamledaghyalctsggqalaelivqek

SCOPe Domain Coordinates for d2mq3a_:

Click to download the PDB-style file with coordinates for d2mq3a_.
(The format of our PDB-style files is described here.)

Timeline for d2mq3a_: