SCOPe 2.08: Domain d2mpca1: 2mpc A:4-92

Lineage for d2mpca1 (2mpc A:4-92)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.77: DEATH domain [47985] (1 superfamily)
   6 helices: closed bundle; greek-key; internal pseudo twofold symmetry

4. Superfamily a.77.1: DEATH domain [47986] (5 families)

5. Family a.77.1.0: automated matches [254238] (1 protein)
   not a true family

6. Protein automated matches [254542] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255408] (6 PDB entries)

8. Domain d2mpca1: 2mpc A:4-92 [257955]
   Other proteins in same PDB: d2mpca2
   automated match to d2hm2q_

Details for d2mpca1

PDB Entry: 2mpc

PDB Description: solution structure of the pyrin domain of human pyrin

PDB Compounds: (A:) pyrin

SCOPe Domain Sequences for d2mpca1:

Sequence; same for both SEQRES and ATOM records:

>d2mpca1 a.77.1.0 (A:4-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tpsdhllstleelvpydfekfkfklqntsvqkehsriprsqiqrarpvkmatllvtyyge
eyavqltlqvlrainqrllaeelhraaiq

Timeline for d2mpca1:

• d2mpca1 first appeared in SCOPe 2.04, called d2mpca_
  
• d2mpca1 appears in SCOPe 2.07