Lineage for d2mpca1 (2mpc A:4-92)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718930Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2718931Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 2719058Family a.77.1.0: automated matches [254238] (1 protein)
    not a true family
  6. 2719059Protein automated matches [254542] (3 species)
    not a true protein
  7. 2719065Species Human (Homo sapiens) [TaxId:9606] [255408] (6 PDB entries)
  8. 2719069Domain d2mpca1: 2mpc A:4-92 [257955]
    Other proteins in same PDB: d2mpca2
    automated match to d2hm2q_

Details for d2mpca1

PDB Entry: 2mpc (more details)

PDB Description: solution structure of the pyrin domain of human pyrin
PDB Compounds: (A:) pyrin

SCOPe Domain Sequences for d2mpca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mpca1 a.77.1.0 (A:4-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tpsdhllstleelvpydfekfkfklqntsvqkehsriprsqiqrarpvkmatllvtyyge
eyavqltlqvlrainqrllaeelhraaiq

SCOPe Domain Coordinates for d2mpca1:

Click to download the PDB-style file with coordinates for d2mpca1.
(The format of our PDB-style files is described here.)

Timeline for d2mpca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mpca2