Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.28: NEAT domain-like [158911] (2 families) |
Family b.1.28.0: automated matches [195425] (1 protein) not a true family |
Protein automated matches [195426] (6 species) not a true protein |
Species Staphylococcus aureus [TaxId:196620] [226676] (2 PDB entries) |
Domain d2moqa_: 2moq A: [257952] automated match to d3ovub_ |
PDB Entry: 2moq (more details)
SCOPe Domain Sequences for d2moqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2moqa_ b.1.28.0 (A:) automated matches {Staphylococcus aureus [TaxId: 196620]} lnqelreaiknpaikdkdhsapnsrpidfemkkkdgtqqfyhyassvkparviftdskpe ielglqsgqfwrkfevyegdkklpiklvsydtvkdyayirfsvsngtkavkivssthfnn keekydytlmefaqpiynsadkfkteed
Timeline for d2moqa_: