Lineage for d2moqa_ (2moq A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766795Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. 2766841Family b.1.28.0: automated matches [195425] (1 protein)
    not a true family
  6. 2766842Protein automated matches [195426] (7 species)
    not a true protein
  7. 2766884Species Staphylococcus aureus [TaxId:196620] [226676] (2 PDB entries)
  8. 2766886Domain d2moqa_: 2moq A: [257952]
    automated match to d3ovub_

Details for d2moqa_

PDB Entry: 2moq (more details)

PDB Description: Solution Structure and Molecular determinants of Hemoglobin Binding of the first NEAT Domain of IsdB in Staphylococcus aureus
PDB Compounds: (A:) Iron-regulated surface determinant protein B

SCOPe Domain Sequences for d2moqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2moqa_ b.1.28.0 (A:) automated matches {Staphylococcus aureus [TaxId: 196620]}
lnqelreaiknpaikdkdhsapnsrpidfemkkkdgtqqfyhyassvkparviftdskpe
ielglqsgqfwrkfevyegdkklpiklvsydtvkdyayirfsvsngtkavkivssthfnn
keekydytlmefaqpiynsadkfkteed

SCOPe Domain Coordinates for d2moqa_:

Click to download the PDB-style file with coordinates for d2moqa_.
(The format of our PDB-style files is described here.)

Timeline for d2moqa_: