SCOPe 2.08: Domain d4mnpa1: 4mnp A:3-306

Lineage for d4mnpa1 (4mnp A:3-306)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Fusobacterium nucleatum [TaxId:190304] [257501] (2 PDB entries)

8. Domain d4mnpa1: 4mnp A:3-306 [257950]
   Other proteins in same PDB: d4mnpa2
   automated match to d4n6ka_
   complexed with slb

Details for d4mnpa1

PDB Entry: 4mnp, 2.5 Å

PDB Description: structure of the sialic acid binding protein from fusobacterium nucleatum subsp. nucleatum atcc 25586

PDB Compounds: (A:) N-acetylneuraminate-binding protein

SCOPe Domain Sequences for d4mnpa1:

Sequence; same for both SEQRES and ATOM records:

>d4mnpa1 c.94.1.0 (A:3-306) automated matches {Fusobacterium nucleatum [TaxId: 190304]}
kynlkmgmtagtsqneykaaevfakelkkrsngeielklypnaqlgkddlammqqlegga
ldftfaetgrfstffpeaevftlpymikdfnhmkkavntkfgkdlfkkvhdkkgmtvlaq
ayngtrqttsnkaiksladmkgmklrvpgaaanlayakyteaaptpmafsevylalqtna
vdgqenplstikaqkfyevqkylamtnhilndqlylvsnitmeelpenlqkvvkesaeva
aeyhtklfmdeekslkdffkskgvtitepnlvdfkkamkpfydeyikkngkvgenaikai
eavr

Timeline for d4mnpa1:

• d4mnpa1 first appeared in SCOPe 2.04, called d4mnpa_
  
• d4mnpa1 appears in SCOPe 2.07