SCOPe 2.04: Domain d4mmpa_: 4mmp A:

Lineage for d4mmpa_ (4mmp A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (42 proteins)

6. Protein automated matches [190140] (17 species)
   not a true protein

7. Species Pasteurella multocida [TaxId:1169409] [257948] (1 PDB entry)

8. Domain d4mmpa_: 4mmp A: [257949]
   automated match to d2cexd_
   complexed with slb

Details for d4mmpa_

PDB Entry: 4mmp, 1.57 Å

PDB Description: structure of sialic acid binding protein from pasturella multocida

PDB Compounds: (A:) Sialic Acid Binding Protein

SCOPe Domain Sequences for d4mmpa_:

Sequence; same for both SEQRES and ATOM records:

>d4mmpa_ c.94.1.1 (A:) automated matches {Pasteurella multocida [TaxId: 1169409]}
gadydlkfgmvagpssneykaveffakevkeksngkidvaifpssqlgddrvmikqlkdg
aldftlgesarfqiyfpeaevfalpymipnfetskkalldtkfgqgllkkidkelnvqvl
svayngtrqttsnrainsiedmkglklrvpnaatnlayakyvgaaptpmafsevylalqt
nsvdgqenplptiqaqkfyevqkylaltnhilndqlylisndtladlpedlqkvvkdaaa
kaaeyhtklfvdgenslveffksqgvtvtqpdlkpfkaaltpyydeylkkngevgkmaie
eisnlakl

Timeline for d4mmpa_:

• d4mmpa_ is new in SCOPe 2.04-stable
  
• d4mmpa_ appears in SCOPe 2.05
  
• d4mmpa_ appears in the current release, SCOPe 2.08, called d4mmpa1