SCOPe 2.08: Domain d4mmpa1: 4mmp A:3-308

Lineage for d4mmpa1 (4mmp A:3-308)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein automated matches [190140] (37 species)
   not a true protein

7. Species Pasteurella multocida [TaxId:1169409] [257948] (1 PDB entry)

8. Domain d4mmpa1: 4mmp A:3-308 [257949]
   Other proteins in same PDB: d4mmpa2, d4mmpa3
   automated match to d2cexd_
   complexed with slb

Details for d4mmpa1

PDB Entry: 4mmp, 1.57 Å

PDB Description: structure of sialic acid binding protein from pasturella multocida

PDB Compounds: (A:) Sialic Acid Binding Protein

SCOPe Domain Sequences for d4mmpa1:

Sequence; same for both SEQRES and ATOM records:

>d4mmpa1 c.94.1.1 (A:3-308) automated matches {Pasteurella multocida [TaxId: 1169409]}
adydlkfgmvagpssneykaveffakevkeksngkidvaifpssqlgddrvmikqlkdga
ldftlgesarfqiyfpeaevfalpymipnfetskkalldtkfgqgllkkidkelnvqvls
vayngtrqttsnrainsiedmkglklrvpnaatnlayakyvgaaptpmafsevylalqtn
svdgqenplptiqaqkfyevqkylaltnhilndqlylisndtladlpedlqkvvkdaaak
aaeyhtklfvdgenslveffksqgvtvtqpdlkpfkaaltpyydeylkkngevgkmaiee
isnlak

Timeline for d4mmpa1:

• d4mmpa1 first appeared in SCOPe 2.04, called d4mmpa_
  
• d4mmpa1 appears in SCOPe 2.07