SCOPe 2.04: Domain d2mlka_: 2mlk A:

Lineage for d2mlka_ (2mlk A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.0: automated matches [191513] (1 protein)
   not a true family

6. Protein automated matches [190858] (12 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [255310] (3 PDB entries)

8. Domain d2mlka_: 2mlk A: [257942]
   automated match to d3zq7a_

Details for d2mlka_

PDB Entry: 2mlk

PDB Description: Three-dimensional structure of the C-terminal DNA-binding domain of RstA protein from Klebsiella pneumoniae

PDB Compounds: (A:) RstA

SCOPe Domain Sequences for d2mlka_:

Sequence; same for both SEQRES and ATOM records:

>d2mlka_ a.4.6.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
gtltphktisfgsltidpvnrqvllggenvalstadfdllwelathagqimdrdallknl
rgvtydgmdrsvdvaisrlrkklldnatepyriktvrnkgylfaphawdn

Timeline for d2mlka_:

• d2mlka_ is new in SCOPe 2.04-stable
  
• d2mlka_ appears in SCOPe 2.05
  
• d2mlka_ appears in the current release, SCOPe 2.08, called d2mlka1