Class a: All alpha proteins [46456] (285 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
Family a.4.6.0: automated matches [191513] (1 protein) not a true family |
Protein automated matches [190858] (12 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [255310] (3 PDB entries) |
Domain d2mlka_: 2mlk A: [257942] automated match to d3zq7a_ |
PDB Entry: 2mlk (more details)
SCOPe Domain Sequences for d2mlka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mlka_ a.4.6.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]} gtltphktisfgsltidpvnrqvllggenvalstadfdllwelathagqimdrdallknl rgvtydgmdrsvdvaisrlrkklldnatepyriktvrnkgylfaphawdn
Timeline for d2mlka_: