SCOPe 2.08: Domain d2mlka1: 2mlk A:131-239

Lineage for d2mlka1 (2mlk A:131-239)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.0: automated matches [191513] (1 protein)
   not a true family

6. Protein automated matches [190858] (25 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [255310] (3 PDB entries)

8. Domain d2mlka1: 2mlk A:131-239 [257942]
   Other proteins in same PDB: d2mlka2
   automated match to d3zq7a_

Details for d2mlka1

PDB Entry: 2mlk

PDB Description: Three-dimensional structure of the C-terminal DNA-binding domain of RstA protein from Klebsiella pneumoniae

PDB Compounds: (A:) RstA

SCOPe Domain Sequences for d2mlka1:

Sequence; same for both SEQRES and ATOM records:

>d2mlka1 a.4.6.0 (A:131-239) automated matches {Klebsiella pneumoniae [TaxId: 573]}
tltphktisfgsltidpvnrqvllggenvalstadfdllwelathagqimdrdallknlr
gvtydgmdrsvdvaisrlrkklldnatepyriktvrnkgylfaphawdn

Timeline for d2mlka1:

• d2mlka1 first appeared in SCOPe 2.04, called d2mlka_
  
• d2mlka1 appears in SCOPe 2.07