Lineage for d2mklc_ (2mkl C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519205Species Ginglymostoma cirratum [TaxId:7801] [257940] (4 PDB entries)
  8. 1519211Domain d2mklc_: 2mkl C: [257941]
    automated match to d3dj9a_

Details for d2mklc_

PDB Entry: 2mkl (more details)

PDB Description: Solution structure of the fourth constant immunoglobulin domain of nurse shark IgNAR
PDB Compounds: (C:) novel antigen receptor

SCOPe Domain Sequences for d2mklc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mklc_ b.1.1.0 (C:) automated matches {Ginglymostoma cirratum [TaxId: 7801]}
mgrqtdisvsllkppfeeiwtqqtativceivysdlenikvfwqvngverkkgvetqnpe
wsgskstivsklkvmasewdsgteyvclvedselptpvkasirka

SCOPe Domain Coordinates for d2mklc_:

Click to download the PDB-style file with coordinates for d2mklc_.
(The format of our PDB-style files is described here.)

Timeline for d2mklc_:

  • d2mklc_ appears in periodic updates to SCOPe 2.04 starting on 2014-07-31
  • d2mklc_ appears in SCOPe 2.05
  • d2mklc_ appears in the current release, SCOPe 2.07, called d2mklc1