Lineage for d1gbla_ (1gbl A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064172Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 2064178Protein alpha-Lytic protease [50498] (1 species)
  7. 2064179Species Lysobacter enzymogenes, 495 [TaxId:69] [50499] (45 PDB entries)
  8. 2064214Domain d1gbla_: 1gbl A: [25794]
    complexed with so4

Details for d1gbla_

PDB Entry: 1gbl (more details), 2.15 Å

PDB Description: alpha-lytic protease with met 190 replaced by ala complex with methoxysuccinyl-ala-ala-pro-leucine boronic acid
PDB Compounds: (A:) alpha-lytic protease

SCOPe Domain Sequences for d1gbla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gbla_ b.47.1.1 (A:) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]}
anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt
anyaegavrgltqgnacagrgdsggswitsagqaqgvmsggnvqsngnncgipasqrssl
ferlqpilsqyglslvtg

SCOPe Domain Coordinates for d1gbla_:

Click to download the PDB-style file with coordinates for d1gbla_.
(The format of our PDB-style files is described here.)

Timeline for d1gbla_: