Class b: All beta proteins [48724] (177 folds) |
Fold b.151: CsrA-like [117129] (1 superfamily) sandwich; 10 strands in 2 sheets; intertwined dimer (segment-swapped, 5-stranded greek-key sandwich?) |
Superfamily b.151.1: CsrA-like [117130] (2 families) |
Family b.151.1.1: CsrA-like [117131] (2 proteins) Pfam PF02599 |
Protein automated matches [190528] (3 species) not a true protein |
Species Pseudomonas protegens [TaxId:220664] [256427] (2 PDB entries) |
Domain d2mf0c_: 2mf0 C: [257937] automated match to d2btia_ protein/RNA complex |
PDB Entry: 2mf0 (more details)
SCOPe Domain Sequences for d2mf0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mf0c_ b.151.1.1 (C:) automated matches {Pseudomonas protegens [TaxId: 220664]} mliltrkvgesinigddititilgvsgqqvriginapkdvavhreeiyqriqagltapd
Timeline for d2mf0c_: