SCOPe 2.05: Domain d2me9a_: 2me9 A:

Lineage for d2me9a_ (2me9 A:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Apoptosis regulator Bcl-xL [56856] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56857] (32 PDB entries)

8. Domain d2me9a_: 2me9 A: [257935]
   automated match to d1bxla_

Details for d2me9a_

PDB Entry: 2me9

PDB Description: Solution structure of BCL-xL containing the alpha1-alpha2 disordered loop determined with selective isotope labelling of I,L,V sidechains

PDB Compounds: (A:) Bcl-2-like protein 1

SCOPe Domain Sequences for d2me9a_:

Sequence; same for both SEQRES and ATOM records:

>d2me9a_ f.1.4.1 (A:) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
ghsmsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegtesemetpsaingnpsw
hladspavngatghsssldarevipmaavkqalreagdefelryrrafsdltsqlhitpg
tayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylndh
lepwiqenggwdtfvelygnnaaaesrkgqer

Timeline for d2me9a_:

• d2me9a_ first appeared in SCOPe 2.04
  
• d2me9a_ is called d2me9a1 in SCOPe 2.06
  
• d2me9a_ appears in the current release, SCOPe 2.08, called d2me9a1