Lineage for d4mbea_ (4mbe A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711203Protein automated matches [190064] (21 species)
    not a true protein
  7. 2711206Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188855] (3 PDB entries)
  8. 2711212Domain d4mbea_: 4mbe A: [257931]
    Other proteins in same PDB: d4mbec_, d4mbef_
    automated match to d3fwba_
    protein/RNA complex; complexed with ca

Details for d4mbea_

PDB Entry: 4mbe (more details), 2.61 Å

PDB Description: Sac3:Sus1:Cdc31:Nup1 complex
PDB Compounds: (A:) Cell division control protein 31

SCOPe Domain Sequences for d4mbea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mbea_ a.39.1.5 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lnselleeqkqeiyeafslfdmnndgfldyhelkvamkalgfelpkreildlideydseg
rhlmkyddfyivmgekilkrdpldeikrafqlfdddhtgkisiknlrrvakelgetltde
elramieefdldgdgeinenefiaictds

SCOPe Domain Coordinates for d4mbea_:

Click to download the PDB-style file with coordinates for d4mbea_.
(The format of our PDB-style files is described here.)

Timeline for d4mbea_: