Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
Domain d4lu5m1: 4lu5 M:1-112 [257909] Other proteins in same PDB: d4lu5h_, d4lu5i_, d4lu5l2, d4lu5m2 automated match to d2g2ra1 |
PDB Entry: 4lu5 (more details), 2.9 Å
SCOPe Domain Sequences for d4lu5m1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lu5m1 b.1.1.0 (M:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dvvmtqtpltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrliylvskld sgvpdrftgsgsgtdftlkisrveaedlgiyycvqgthfpytfgggtkleik
Timeline for d4lu5m1:
View in 3D Domains from other chains: (mouse over for more information) d4lu5h_, d4lu5i_, d4lu5l1, d4lu5l2 |