SCOPe 2.08: Domain d4luga_: 4lug A:

Lineage for d4luga_ (4lug A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families)

5. Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
   barrel, closed; n=5, S=8

6. Protein Inorganic pyrophosphatase [50326] (9 species)
   eukaryotic enzyme has additional secondary structures at both N- and C-termini

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [257893] (2 PDB entries)

8. Domain d4luga_: 4lug A: [257894]
   automated match to d1twla_
   complexed with na

Details for d4luga_

PDB Entry: 4lug, 1.93 Å

PDB Description: Crystal structure of Inorganic Pyrophosphatase PPA1 from Arabidopsis thaliana

PDB Compounds: (A:) inorganic pyrophosphatase

SCOPe Domain Sequences for d4luga_:

Sequence; same for both SEQRES and ATOM records:

>d4luga_ b.40.5.1 (A:) Inorganic pyrophosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ahpwhdleigpgapqifnvvveitkgskvkyeldkktglikvdrilyssvvyphnygfvp
rtlcedndpidvlvimqepvlpgcflraraiglmpmidqgekddkiiavcvddpeykhyt
dikelpphrlseirrffedykknenkevavndflpsesaveaiqysmdlyaeyil

Timeline for d4luga_:

• d4luga_ first appeared in SCOPe 2.04
  
• d4luga_ appears in SCOPe 2.07