Lineage for d4luka_ (4luk A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2080272Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2080542Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (2 proteins)
    automatically mapped to Pfam PF06560
  6. 2080570Protein automated matches [196263] (1 species)
    not a true protein
  7. 2080571Species Pyrococcus furiosus [TaxId:186497] [196264] (5 PDB entries)
  8. 2080572Domain d4luka_: 4luk A: [257892]
    automated match to d1x82a_
    complexed with edo, mn, pa5; mutant

Details for d4luka_

PDB Entry: 4luk (more details), 1.41 Å

PDB Description: the crystal structure of the p132a, y133g mutant of pyrococcus furiosus phosphoglucose isomerase in complex with manganese and 5- phospho-d-arabinonate.
PDB Compounds: (A:) Glucose-6-phosphate isomerase

SCOPe Domain Sequences for d4luka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4luka_ b.82.1.7 (A:) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
smepgtvvyvpagwahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
vvdnprwkk

SCOPe Domain Coordinates for d4luka_:

Click to download the PDB-style file with coordinates for d4luka_.
(The format of our PDB-style files is described here.)

Timeline for d4luka_: