Lineage for d4luma_ (4lum A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1807020Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1807021Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1807282Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (2 proteins)
    automatically mapped to Pfam PF06560
  6. 1807310Protein automated matches [196263] (1 species)
    not a true protein
  7. 1807311Species Pyrococcus furiosus [TaxId:186497] [196264] (5 PDB entries)
  8. 1807314Domain d4luma_: 4lum A: [257890]
    automated match to d1x82a_
    complexed with f6r, mn; mutant

Details for d4luma_

PDB Entry: 4lum (more details), 1.79 Å

PDB Description: the crystal structure of the p132v mutant of pyrococcus furiosus phosphoglucose isomerase in complex with manganese and fructose-6- phosphate.
PDB Compounds: (A:) Glucose-6-phosphate isomerase

SCOPe Domain Sequences for d4luma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4luma_ b.82.1.7 (A:) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mmykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveq
eekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakw
ismepgtvvyvpvywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengev
kvvdnprwkk

SCOPe Domain Coordinates for d4luma_:

Click to download the PDB-style file with coordinates for d4luma_.
(The format of our PDB-style files is described here.)

Timeline for d4luma_: