SCOPe 2.07: Domain d4ltaa_: 4lta A:

Lineage for d4ltaa_ (4lta A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (2 proteins)
   automatically mapped to Pfam PF06560

6. Protein automated matches [196263] (1 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:186497] [196264] (5 PDB entries)

8. Domain d4ltaa_: 4lta A: [257859]
   automated match to d1x82a_
   complexed with edo, mn, pa5; mutant

Details for d4ltaa_

PDB Entry: 4lta, 2.04 Å

PDB Description: the crystal structure of the p132r, y133g mutant of pyrococcus furiosus phosphoglucose isomerase in complex with manganese and 5- phospho-d-arabinonate.

PDB Compounds: (A:) Glucose-6-phosphate isomerase

SCOPe Domain Sequences for d4ltaa_:

Sequence; same for both SEQRES and ATOM records:

>d4ltaa_ b.82.1.7 (A:) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
smepgtvvyvprgwahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
vvdnprwkk

Timeline for d4ltaa_:

• d4ltaa_ first appeared in SCOPe 2.04
  
• d4ltaa_ appears in SCOPe 2.06
  
• d4ltaa_ appears in the current release, SCOPe 2.08