Class b: All beta proteins [48724] (177 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (2 proteins) automatically mapped to Pfam PF06560 |
Protein automated matches [196263] (1 species) not a true protein |
Species Pyrococcus furiosus [TaxId:186497] [196264] (5 PDB entries) |
Domain d4ltaa_: 4lta A: [257859] automated match to d1x82a_ complexed with edo, mn, pa5; mutant |
PDB Entry: 4lta (more details), 2.04 Å
SCOPe Domain Sequences for d4ltaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ltaa_ b.82.1.7 (A:) automated matches {Pyrococcus furiosus [TaxId: 186497]} mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi smepgtvvyvprgwahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk vvdnprwkk
Timeline for d4ltaa_: