| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein automated matches [190041] (34 species) not a true protein |
| Species Bullfrog (Rana catesbeiana) [TaxId:8400] [189485] (19 PDB entries) |
| Domain d4lpna_: 4lpn A: [257850] automated match to d3shxa_ complexed with cl, co, mg; mutant |
PDB Entry: 4lpn (more details), 1.66 Å
SCOPe Domain Sequences for d4lpna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lpna_ a.25.1.1 (A:) automated matches {Bullfrog (Rana catesbeiana) [TaxId: 8400]}
vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
vdphlcefleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvk
Timeline for d4lpna_: