| Class b: All beta proteins [48724] (180 folds) |
| Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
| Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
| Protein alpha-Lytic protease [50498] (1 species) |
| Species Lysobacter enzymogenes, 495 [TaxId:69] [50499] (46 PDB entries) |
| Domain d1gbba_: 1gbb A: [25785] complexed with so4 |
PDB Entry: 1gbb (more details), 2.15 Å
SCOPe Domain Sequences for d1gbba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gbba_ b.47.1.1 (A:) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]}
anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt
anyaegavrgltqgnacagrgdsggswitsagqaqgvmsganvqsngnncgipasqrssl
ferlqpilsqyglslvtg
Timeline for d1gbba_: