| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
| Protein automated matches [190140] (37 species) not a true protein |
| Species Salmonella enterica [TaxId:99287] [227690] (7 PDB entries) |
| Domain d4lq5a_: 4lq5 A: [257849] automated match to d4gxaa_ protein/DNA complex; complexed with oas |
PDB Entry: 4lq5 (more details), 2.8 Å
SCOPe Domain Sequences for d4lq5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lq5a_ c.94.1.1 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
ehtwpdkgslyiatthtqaryalpgvikgfieryprvslhmhqgsptqiaeavskgnadf
aiatealhlyddlvmlpcyhwnrsivvtpdhplaatssvtiealaqyplvtytfgftgrs
eldtafnragltprivftatdadviktyvrlglgvgviasmavdpladpdlvridahdif
shsttkigfrrstflrsymydfiqrfaphltrdvvdtavalrsneeieamfqdiklpek
Timeline for d4lq5a_: