SCOPe 2.08: Domain d4lq5a_: 4lq5 A:

Lineage for d4lq5a_ (4lq5 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein automated matches [190140] (37 species)
   not a true protein

7. Species Salmonella enterica [TaxId:99287] [227690] (7 PDB entries)

8. Domain d4lq5a_: 4lq5 A: [257849]
   automated match to d4gxaa_
   protein/DNA complex; complexed with oas

Details for d4lq5a_

PDB Entry: 4lq5, 2.8 Å

PDB Description: Crystal structure of ligand binding domain of CysB, a LysR member from Salmonella typhimurium LT2 in complex with effector ligand, O-acetylserine at 2.8A

PDB Compounds: (A:) HTH-type transcriptional regulator CysB

SCOPe Domain Sequences for d4lq5a_:

Sequence; same for both SEQRES and ATOM records:

>d4lq5a_ c.94.1.1 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
ehtwpdkgslyiatthtqaryalpgvikgfieryprvslhmhqgsptqiaeavskgnadf
aiatealhlyddlvmlpcyhwnrsivvtpdhplaatssvtiealaqyplvtytfgftgrs
eldtafnragltprivftatdadviktyvrlglgvgviasmavdpladpdlvridahdif
shsttkigfrrstflrsymydfiqrfaphltrdvvdtavalrsneeieamfqdiklpek

Timeline for d4lq5a_:

• d4lq5a_ first appeared in SCOPe 2.04
  
• d4lq5a_ appears in SCOPe 2.07