SCOPe 2.08: Domain d4lm6d_: 4lm6 D:

Lineage for d4lm6d_ (4lm6 D:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein automated matches [190531] (23 species)
   not a true protein

7. Species Hemiselmis virescens [TaxId:77927] [257033] (1 PDB entry)

8. Domain d4lm6d_: 4lm6 D: [257843]
   automated match to d1xg0d_
   complexed with cyc, dbv

Details for d4lm6d_

PDB Entry: 4lm6, 1.7 Å

PDB Description: light harvesting complex pc612 from the cryptophyte hemiselmis virescens m1635

PDB Compounds: (D:) cryptophyte phycocyanin beta chain

SCOPe Domain Sequences for d4lm6d_:

Sequence; same for both SEQRES and ATOM records:

>d4lm6d_ a.1.1.3 (D:) automated matches {Hemiselmis virescens [TaxId: 77927]}
dafskvitsadgkaayvggadlqalkkfvsdgnkrmdavnaivsnascivsdavsgmvce
npaliapnggvysnrkmaaclrdaeiilryvsysllsgdssvledrclnglketyaslgv
paagnaravaimkatvngfinntaqqkklstpagdcsalaseaggyfdkvssala

Timeline for d4lm6d_:

• d4lm6d_ first appeared in SCOPe 2.04
  
• d4lm6d_ appears in SCOPe 2.07