Lineage for d4lmxf_ (4lmx F:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1979008Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1979193Protein automated matches [190531] (18 species)
    not a true protein
  7. 1979218Species Hemiselmis andersenii [TaxId:464988] [257044] (1 PDB entry)
  8. 1979221Domain d4lmxf_: 4lmx F: [257842]
    automated match to d1xg0d_
    complexed with dbv, peb

Details for d4lmxf_

PDB Entry: 4lmx (more details), 1.8 Å

PDB Description: Light harvesting complex PE555 from the cryptophyte Hemiselmis andersenii CCMP644
PDB Compounds: (F:) cryptophyte phycoerythrin (beta chain)

SCOPe Domain Sequences for d4lmxf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lmxf_ a.1.1.3 (F:) automated matches {Hemiselmis andersenii [TaxId: 464988]}
ldafskvitsadgkaayvggadlqalkkfvsegnkrmdsvnaivsnascivsdsvsgmvc
enpsliapnggvytnrkmaaclrdaeiilryvsysllsgdssvledrclnglketyaslg
vpaagnartisimkatvigfitnnsqqkklstpagdcsalasevggyfdkvssala

SCOPe Domain Coordinates for d4lmxf_:

Click to download the PDB-style file with coordinates for d4lmxf_.
(The format of our PDB-style files is described here.)

Timeline for d4lmxf_: