Lineage for d4ljma_ (4ljm A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2558725Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2559336Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2559337Protein automated matches [190896] (11 species)
    not a true protein
  7. 2559375Species Human (Homo sapiens) [TaxId:9606] [188315] (105 PDB entries)
  8. 2559451Domain d4ljma_: 4ljm A: [257840]
    automated match to d2rraa_

Details for d4ljma_

PDB Entry: 4ljm (more details), 3 Å

PDB Description: Crystal structure of C-terminal RNA recognition motif of human ETR3
PDB Compounds: (A:) CUGBP Elav-like family member 2

SCOPe Domain Sequences for d4ljma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ljma_ d.58.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpeganlfiyhlpqefgdqdilqmfmpfgnvisakvfidkqtnlskcfgfvsydnpvsaq
aaiqamngfqigmkrlkvqlk

SCOPe Domain Coordinates for d4ljma_:

Click to download the PDB-style file with coordinates for d4ljma_.
(The format of our PDB-style files is described here.)

Timeline for d4ljma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4ljmb_