SCOPe 2.07: Domain d4le2b1: 4le2 B:1-130

Lineage for d4le2b1 (4le2 B:1-130)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (84 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [257830] (6 PDB entries)

8. Domain d4le2b1: 4le2 B:1-130 [257832]
   Other proteins in same PDB: d4le2b2, d4le2c2, d4le2d2
   automated match to d3t8ya_
   complexed with k, po4

Details for d4le2b1

PDB Entry: 4le2, 2.54 Å

PDB Description: crystal structure of the unphosphorylated receiver domain of desr in the active state

PDB Compounds: (B:) Transcriptional regulatory protein DesR

SCOPe Domain Sequences for d4le2b1:

Sequence, based on SEQRES records:

>d4le2b1 c.23.1.0 (B:1-130) automated matches {Bacillus subtilis [TaxId: 224308]}
misifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempgk
tgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvmngk
riyapelmed

Sequence, based on observed residues (ATOM records):

>d4le2b1 c.23.1.0 (B:1-130) automated matches {Bacillus subtilis [TaxId: 224308]}
misifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempgk
tgleaaeelkdtgckiiilttfpgyfqraikagvkgyllkdspseelanairsvmngkri
yapelmed

Timeline for d4le2b1:

• d4le2b1 first appeared in SCOPe 2.04, called d4le2b_
  
• d4le2b1 appears in SCOPe 2.06
  
• d4le2b1 appears in the current release, SCOPe 2.08