Lineage for d4le2b1 (4le2 B:1-130)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2855841Species Bacillus subtilis [TaxId:224308] [257830] (6 PDB entries)
  8. 2855847Domain d4le2b1: 4le2 B:1-130 [257832]
    Other proteins in same PDB: d4le2b2, d4le2c2, d4le2d2
    automated match to d3t8ya_
    complexed with k, po4

Details for d4le2b1

PDB Entry: 4le2 (more details), 2.54 Å

PDB Description: crystal structure of the unphosphorylated receiver domain of desr in the active state
PDB Compounds: (B:) Transcriptional regulatory protein DesR

SCOPe Domain Sequences for d4le2b1:

Sequence, based on SEQRES records: (download)

>d4le2b1 c.23.1.0 (B:1-130) automated matches {Bacillus subtilis [TaxId: 224308]}
misifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempgk
tgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvmngk
riyapelmed

Sequence, based on observed residues (ATOM records): (download)

>d4le2b1 c.23.1.0 (B:1-130) automated matches {Bacillus subtilis [TaxId: 224308]}
misifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempgk
tgleaaeelkdtgckiiilttfpgyfqraikagvkgyllkdspseelanairsvmngkri
yapelmed

SCOPe Domain Coordinates for d4le2b1:

Click to download the PDB-style file with coordinates for d4le2b1.
(The format of our PDB-style files is described here.)

Timeline for d4le2b1: