SCOPe 2.04: Domain d4le2a_: 4le2 A:

Lineage for d4le2a_ (4le2 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (54 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [257830] (1 PDB entry)

8. Domain d4le2a_: 4le2 A: [257831]
   automated match to d3t8ya_
   complexed with k, po4

Details for d4le2a_

PDB Entry: 4le2, 2.54 Å

PDB Description: crystal structure of the unphosphorylated receiver domain of desr in the active state

PDB Compounds: (A:) Transcriptional regulatory protein DesR

SCOPe Domain Sequences for d4le2a_:

Sequence; same for both SEQRES and ATOM records:

>d4le2a_ c.23.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
misifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempgk
tgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvmngk
riyapelmedly

Timeline for d4le2a_:

• d4le2a_ is new in SCOPe 2.04-stable
  
• d4le2a_ appears in SCOPe 2.05
  
• d4le2a_ appears in the current release, SCOPe 2.08