Lineage for d4lbqa_ (4lbq A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779190Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2779456Protein automated matches [190029] (6 species)
    not a true protein
  7. 2779525Species Mouse (Mus musculus) [TaxId:10090] [257827] (2 PDB entries)
  8. 2779528Domain d4lbqa_: 4lbq A: [257828]
    automated match to d4ga9a_
    complexed with gol

Details for d4lbqa_

PDB Entry: 4lbq (more details), 2.4 Å

PDB Description: crystal structure of mouse galectin-1
PDB Compounds: (A:) galectin-1

SCOPe Domain Sequences for d4lbqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lbqa_ b.29.1.3 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
cglvasnlnlkpgeclkvrgevasdaksfvlnlgkdsnnlclhfnprfnahgdantivcn
tkedgtwgtehrepafpfqpgsitevcitfdqadltiklpdghefkfpnrlnmeainyma
adgdfkikcvafe

SCOPe Domain Coordinates for d4lbqa_:

Click to download the PDB-style file with coordinates for d4lbqa_.
(The format of our PDB-style files is described here.)

Timeline for d4lbqa_: