SCOPe 2.05: Domain d4l07a_: 4l07 A:

Lineage for d4l07a_ (4l07 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families)

5. Family c.33.1.0: automated matches [191389] (1 protein)
   not a true family

6. Protein automated matches [190499] (20 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:1042876] [257820] (2 PDB entries)

8. Domain d4l07a_: 4l07 A: [257822]
   automated match to d3ot4c_
   complexed with gol, so4

Details for d4l07a_

PDB Entry: 4l07, 1.75 Å

PDB Description: crystal structure of the maleamate amidase ami from pseudomonas putida s16

PDB Compounds: (A:) Hydrolase, isochorismatase family

SCOPe Domain Sequences for d4l07a_:

Sequence; same for both SEQRES and ATOM records:

>d4l07a_ c.33.1.0 (A:) automated matches {Pseudomonas putida [TaxId: 1042876]}
msqkevydaagfgnpvsrgvhpaiivvdfsygftdlqyptasdaslqmsrtkeicdlara
lefpvifttiayhpgeipmlpwlekssgmaallygsrlveidmatgiqpndvvvvkkgas
sffgstlssllagtntdtvvvtgattsgcvratvvdavqsgfkvlvpadccadrakgphe
aslydiqqkygdvtdsddilkwlrsvag

Timeline for d4l07a_:

• d4l07a_ first appeared in SCOPe 2.04
  
• d4l07a_ appears in SCOPe 2.06
  
• d4l07a_ appears in the current release, SCOPe 2.08