Lineage for d4kttd3 (4ktt D:252-395)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1926950Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 1926951Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 1926952Family d.130.1.1: S-adenosylmethionine synthetase [55974] (1 protein)
  6. 1926953Protein S-adenosylmethionine synthetase [55975] (3 species)
    synonym: methionine adenosyltransferase, MAT
  7. 1927003Species Human (Homo sapiens), isoform type-2 [TaxId:9606] [160759] (2 PDB entries)
    Uniprot P31153 126-251! Uniprot P31153 16-125! Uniprot P31153 252-395
    MAT2A
  8. 1927018Domain d4kttd3: 4ktt D:252-395 [257816]
    Other proteins in same PDB: d4ktte_, d4kttf_
    automated match to d2p02a3
    complexed with edo, mg, po4, sam

Details for d4kttd3

PDB Entry: 4ktt (more details), 2.59 Å

PDB Description: structural insights of mat enzymes: mata2b complexed with sam
PDB Compounds: (D:) S-adenosylmethionine synthase isoform type-2

SCOPe Domain Sequences for d4kttd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kttd3 d.130.1.1 (D:252-395) S-adenosylmethionine synthetase {Human (Homo sapiens), isoform type-2 [TaxId: 9606]}
iggpqgdagltgrkiivdtyggwgahgggafsgkdytkvdrsaayaarwvakslvkgglc
rrvlvqvsyaigvshplsisifhygtsqkserelleivkknfdlrpgvivrdldlkkpiy
qrtaayghfgrdsfpwevpkklky

SCOPe Domain Coordinates for d4kttd3:

Click to download the PDB-style file with coordinates for d4kttd3.
(The format of our PDB-style files is described here.)

Timeline for d4kttd3: