Lineage for d4ktta1 (4ktt A:15-115)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1669649Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 1669650Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 1669651Family d.130.1.1: S-adenosylmethionine synthetase [55974] (1 protein)
  6. 1669652Protein S-adenosylmethionine synthetase [55975] (3 species)
    synonym: methionine adenosyltransferase, MAT
  7. 1669702Species Human (Homo sapiens), isoform type-2 [TaxId:9606] [160759] (2 PDB entries)
    Uniprot P31153 126-251! Uniprot P31153 16-125! Uniprot P31153 252-395
    MAT2A
  8. 1669706Domain d4ktta1: 4ktt A:15-115 [257811]
    Other proteins in same PDB: d4kttf_
    automated match to d2p02a1
    complexed with edo, mg, po4, sam

Details for d4ktta1

PDB Entry: 4ktt (more details), 2.59 Å

PDB Description: structural insights of mat enzymes: mata2b complexed with sam
PDB Compounds: (A:) S-adenosylmethionine synthase isoform type-2

SCOPe Domain Sequences for d4ktta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ktta1 d.130.1.1 (A:15-115) S-adenosylmethionine synthetase {Human (Homo sapiens), isoform type-2 [TaxId: 9606]}
egtflftsesvgeghpdkicdqisdavldahlqqdpdakvacetvaktgmillageitsr
aavdyqkvvreavkhigyddsskgfdyktcnvlvaleqqsp

SCOPe Domain Coordinates for d4ktta1:

Click to download the PDB-style file with coordinates for d4ktta1.
(The format of our PDB-style files is described here.)

Timeline for d4ktta1: