Lineage for d3prob_ (3pro B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1793085Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 1793091Protein alpha-Lytic protease [50498] (1 species)
  7. 1793092Species Lysobacter enzymogenes, 495 [TaxId:69] [50499] (45 PDB entries)
  8. 1793116Domain d3prob_: 3pro B: [25781]
    Other proteins in same PDB: d3proc1, d3proc2, d3prod1, d3prod2
    complexed with aes

Details for d3prob_

PDB Entry: 3pro (more details), 1.8 Å

PDB Description: alpha-lytic protease complexed with c-terminal truncated pro region
PDB Compounds: (B:) alpha-lytic protease

SCOPe Domain Sequences for d3prob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3prob_ b.47.1.1 (B:) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]}
anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt
anyaegavrgltqgnacmgrgdsggswitsagqaqgvasggnvqsngnncgipasqrssl
ferlqpilsqyglslvtg

SCOPe Domain Coordinates for d3prob_:

Click to download the PDB-style file with coordinates for d3prob_.
(The format of our PDB-style files is described here.)

Timeline for d3prob_: