SCOPe 2.05: Domain d3prob_: 3pro B:

Lineage for d3prob_ (3pro B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)

6. Protein alpha-Lytic protease [50498] (1 species)

7. Species Lysobacter enzymogenes, 495 [TaxId:69] [50499] (45 PDB entries)

8. Domain d3prob_: 3pro B: [25781]
   Other proteins in same PDB: d3proc1, d3proc2, d3prod1, d3prod2
   complexed with aes

Details for d3prob_

PDB Entry: 3pro, 1.8 Å

PDB Description: alpha-lytic protease complexed with c-terminal truncated pro region

PDB Compounds: (B:) alpha-lytic protease

SCOPe Domain Sequences for d3prob_:

Sequence; same for both SEQRES and ATOM records:

>d3prob_ b.47.1.1 (B:) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]}
anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt
anyaegavrgltqgnacmgrgdsggswitsagqaqgvasggnvqsngnncgipasqrssl
ferlqpilsqyglslvtg

Timeline for d3prob_:

• d3prob_ first appeared (with stable ids) in SCOP 1.55
  
• d3prob_ appears in SCOPe 2.04
  
• d3prob_ appears in SCOPe 2.06
  
• d3prob_ appears in the current release, SCOPe 2.08