SCOPe 2.07: Domain d4kpca1: 4kpc A:3-142

Lineage for d4kpca1 (4kpc A:3-142)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (18 species)
   not a true protein

7. Species Leishmania braziliensis [TaxId:5660] [257801] (1 PDB entry)

8. Domain d4kpca1: 4kpc A:3-142 [257803]
   Other proteins in same PDB: d4kpca2, d4kpcb2
   automated match to d1zs6a1
   complexed with po4

Details for d4kpca1

PDB Entry: 4kpc, 2.7 Å

PDB Description: crystal structure of the nucleoside diphosphate kinase b from leishmania braziliensis

PDB Compounds: (A:) Nucleoside diphosphate kinase B

SCOPe Domain Sequences for d4kpca1:

Sequence; same for both SEQRES and ATOM records:

>d4kpca1 d.58.6.1 (A:3-142) automated matches {Leishmania braziliensis [TaxId: 5660]}
sertfiaikpdgvqrglvgeiisrferkgfklvalkmlqptteqaqghykdlaskpffeg
lvkyfssgpivcmvwegknvvksgrvllgatnpadsqpgtirgdyavdvgrnvchgsdsv
esaqrevafwfkveeiaswt

Timeline for d4kpca1:

• d4kpca1 first appeared in SCOPe 2.04, called d4kpca_
  
• d4kpca1 was called d4kpca_ in SCOPe 2.06
  
• d4kpca1 appears in the current release, SCOPe 2.08