Lineage for d4kpca1 (4kpc A:3-142)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2518280Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2518281Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 protein domains)
  6. 2518531Protein automated matches [190032] (18 species)
    not a true protein
  7. 2518675Species Leishmania braziliensis [TaxId:5660] [257801] (1 PDB entry)
  8. 2518676Domain d4kpca1: 4kpc A:3-142 [257803]
    Other proteins in same PDB: d4kpca2, d4kpcb2
    automated match to d1zs6a1
    complexed with po4

Details for d4kpca1

PDB Entry: 4kpc (more details), 2.7 Å

PDB Description: crystal structure of the nucleoside diphosphate kinase b from leishmania braziliensis
PDB Compounds: (A:) Nucleoside diphosphate kinase B

SCOPe Domain Sequences for d4kpca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kpca1 d.58.6.1 (A:3-142) automated matches {Leishmania braziliensis [TaxId: 5660]}
sertfiaikpdgvqrglvgeiisrferkgfklvalkmlqptteqaqghykdlaskpffeg
lvkyfssgpivcmvwegknvvksgrvllgatnpadsqpgtirgdyavdvgrnvchgsdsv
esaqrevafwfkveeiaswt

SCOPe Domain Coordinates for d4kpca1:

Click to download the PDB-style file with coordinates for d4kpca1.
(The format of our PDB-style files is described here.)

Timeline for d4kpca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4kpca2