Lineage for d4k7ic_ (4k7i C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118983Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2118984Protein automated matches [190056] (165 species)
    not a true protein
  7. 2119464Species Human (Homo sapiens) [TaxId:9606] [188013] (106 PDB entries)
  8. 2119665Domain d4k7ic_: 4k7i C: [257800]
    Other proteins in same PDB: d4k7ia2
    automated match to d3umac_
    complexed with caq, dms

Details for d4k7ic_

PDB Entry: 4k7i (more details), 2.25 Å

PDB Description: human peroxiredoxin 5 with a fragment
PDB Compounds: (C:) Peroxiredoxin-5, mitochondrial

SCOPe Domain Sequences for d4k7ic_:

Sequence, based on SEQRES records: (download)

>d4k7ic_ c.47.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apikvgdaipavevfegepgnkvnlaelfkgkkgvlfgvpgaftpgcskthlpgfveqae
alkakgvqvvaclsvndafvtgewgrahkaegkvrlladptgafgketdlllddslvsif
gnrrlkrfsmvvqdgivkalnvepdgtgltcslapniisql

Sequence, based on observed residues (ATOM records): (download)

>d4k7ic_ c.47.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apikvgdaipavevfegepgnkvnlaelfkgkkgvlfgvpgaftpgcskthlpgfveqae
alkakgvqvvaclsvndafvtgewgrahkaegkvrlladptgafgketdlllddslvsif
gnrrlkrfsmvvqdgivkalnvepgtgltcslapniisql

SCOPe Domain Coordinates for d4k7ic_:

Click to download the PDB-style file with coordinates for d4k7ic_.
(The format of our PDB-style files is described here.)

Timeline for d4k7ic_: