SCOPe 2.05: Domain d4k4ge2: 4k4g E:329-385

Lineage for d4k4ge2 (4k4g E:329-385)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
   topological similarity to the N-terminal domain
   automatically mapped to Pfam PF10391

6. Protein DNA polymerase lambda [101253] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101254] (26 PDB entries)

8. Domain d4k4ge2: 4k4g E:329-385 [257794]
   Other proteins in same PDB: d4k4ga1, d4k4ga3, d4k4ge1, d4k4ge3, d4k4gi1, d4k4gi3, d4k4gm1, d4k4gm3
   automated match to d1xsna2
   protein/DNA complex; complexed with 1s0, act, ca, cac

Details for d4k4ge2

PDB Entry: 4k4g, 2.15 Å

PDB Description: ternary crystal structures of human dna polymerase lambda in complex with dna and l-dctp.

PDB Compounds: (E:) DNA polymerase lambda

SCOPe Domain Sequences for d4k4ge2:

Sequence; same for both SEQRES and ATOM records:

>d4k4ge2 a.60.12.1 (E:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

Timeline for d4k4ge2:

• d4k4ge2 first appeared in SCOPe 2.04
  
• d4k4ge2 appears in SCOPe 2.06
  
• d4k4ge2 appears in the current release, SCOPe 2.08