Lineage for d4k4ge2 (4k4g E:329-385)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493397Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1494216Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1494217Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. 1494393Protein DNA polymerase lambda [101253] (1 species)
  7. 1494394Species Human (Homo sapiens) [TaxId:9606] [101254] (25 PDB entries)
  8. 1494430Domain d4k4ge2: 4k4g E:329-385 [257794]
    Other proteins in same PDB: d4k4ga1, d4k4ga3, d4k4ge1, d4k4ge3
    automated match to d1xsna2
    protein/DNA complex; complexed with 1s0, act, ca, cac

Details for d4k4ge2

PDB Entry: 4k4g (more details), 2.15 Å

PDB Description: ternary crystal structures of human dna polymerase lambda in complex with dna and l-dctp.
PDB Compounds: (E:) DNA polymerase lambda

SCOPe Domain Sequences for d4k4ge2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k4ge2 a.60.12.1 (E:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle

SCOPe Domain Coordinates for d4k4ge2:

Click to download the PDB-style file with coordinates for d4k4ge2.
(The format of our PDB-style files is described here.)

Timeline for d4k4ge2: