| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) ![]() contains one classic and one pseudo HhH motifs |
| Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins) topological similarity to the N-terminal domain automatically mapped to Pfam PF10391 |
| Protein DNA polymerase lambda [101253] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [101254] (25 PDB entries) |
| Domain d4k4ge2: 4k4g E:329-385 [257794] Other proteins in same PDB: d4k4ga1, d4k4ga3, d4k4ge1, d4k4ge3 automated match to d1xsna2 protein/DNA complex; complexed with 1s0, act, ca, cac |
PDB Entry: 4k4g (more details), 2.15 Å
SCOPe Domain Sequences for d4k4ge2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k4ge2 a.60.12.1 (E:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
sesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttqqaiglkhysdfle
Timeline for d4k4ge2: