![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins) |
![]() | Protein automated matches [190102] (7 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [257785] (2 PDB entries) |
![]() | Domain d4k4cc_: 4k4c C: [257789] automated match to d1vh9a_ complexed with 0fq |
PDB Entry: 4k4c (more details), 1.85 Å
SCOPe Domain Sequences for d4k4cc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k4cc_ d.38.1.5 (C:) automated matches {Escherichia coli [TaxId: 83333]} miwkrhltldelnatsdntmvahlgivytrlgddvleaempvdtrthqpfgllhggasaa laetlgsmagfmmtrdgqcvvgtelnathhrpvsegkvrgvcqplhlgrqnqsweivvfd eqgrrcctcrlgtavlg
Timeline for d4k4cc_: