SCOPe 2.06: Domain d4k4cd_: 4k4c D:

Lineage for d4k4cd_ (4k4c D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)

6. Protein automated matches [190102] (7 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [257785] (2 PDB entries)

8. Domain d4k4cd_: 4k4c D: [257788]
   automated match to d1vh9a_
   complexed with 0fq

Details for d4k4cd_

PDB Entry: 4k4c, 1.85 Å

PDB Description: X-ray crystal structure of E. coli YbdB complexed with phenacyl-CoA

PDB Compounds: (D:) Proofreading thioesterase EntH

SCOPe Domain Sequences for d4k4cd_:

Sequence; same for both SEQRES and ATOM records:

>d4k4cd_ d.38.1.5 (D:) automated matches {Escherichia coli [TaxId: 83333]}
miwkrhltldelnatsdntmvahlgivytrlgddvleaempvdtrthqpfgllhggasaa
laetlgsmagfmmtrdgqcvvgtelnathhrpvsegkvrgvcqplhlgrqnqsweivvfd
eqgrrcctcrlgtavlg

Timeline for d4k4cd_:

• d4k4cd_ first appeared in SCOPe 2.04
  
• d4k4cd_ appears in SCOPe 2.05
  
• d4k4cd_ appears in SCOPe 2.07
  
• d4k4cd_ appears in the current release, SCOPe 2.08