Lineage for d4jjja_ (4jjj A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004076Family a.102.1.2: Cellulases catalytic domain [48213] (12 protein domains)
  6. 2004171Protein automated matches [196672] (2 species)
    not a true protein
  7. 2004178Species Thermobifida fusca [TaxId:2021] [257783] (1 PDB entry)
  8. 2004179Domain d4jjja_: 4jjj A: [257784]
    automated match to d1g9ga_
    complexed with act, ca, cbi, cbk, ce6, edo, fe, na, zn; mutant

Details for d4jjja_

PDB Entry: 4jjj (more details), 1.6 Å

PDB Description: The structure of T. fusca GH48 D224N mutant
PDB Compounds: (A:) Cellulose 1,4-beta-cellobiosidase

SCOPe Domain Sequences for d4jjja_:

Sequence, based on SEQRES records: (download)

>d4jjja_ a.102.1.2 (A:) automated matches {Thermobifida fusca [TaxId: 2021]}
sydqafleqyekikdpasgyfrefngllvpyhsvetmiveapdhghqttseafsyylwle
ayygrvtgdwkplhdawesmetfiipgtkdqptnsaynpnspatyipeqpnadgypsplm
nnvpvgqdplaqelsstygtneiygmhwlldvdnvygfgfcgdgtddapayintyqrgar
esvwetiphpscddfthggpngyldlftddqnyakqwrytnapnadaravqvmfwahewa
keqgkeneiaglmdkaskmgdylryamfdkyfkkigncvgatscpggqgkdsahyllswy
yswggsldtssawawrigsssshqgyqnvlaayalsqvpelqpdsptgvqdwatsfdrql
eflqwlqsaeggiaggatnswkgsydtpptglsqfygmyydwqpvwndppsnnwfgfqvw
nmervaqlyyvtgdaraeaildkwvpwaiqhtdvdadnggqnfqvpsdlewsgqpdtwtg
tytgnpnlhvqvvsysqdvgvtaalaktlmyyakrsgdttalataeglldallahrdsig
iatpeqpswdrlddpwdgseglyvppgwsgtmpngdriepgatflsirsfykndplwpqv
eahlndpqnvpapiverhrfwaqveiatafaahdelfg

Sequence, based on observed residues (ATOM records): (download)

>d4jjja_ a.102.1.2 (A:) automated matches {Thermobifida fusca [TaxId: 2021]}
sydqafleqyekikdpasgyfrefngllvpyhsvetmiveapdhghqttseafsyylwle
ayygrvtgdwkplhdawesmetfiipgtkdqptnsaynpnspatyipeqpnadgypsplm
nnvpvgqdplaqelsstygtneiygmhwlldvdnvygfgfcgdgtddapayintyqrgar
esvwetiphpscddfthggpngyldlftddqnyakqwrytnapnadaravqvmfwahewa
keqgkeneiaglmdkaskmgdylryamfdkyfkkigncvgatscpggqgkdsahyllswy
yswggsldsawawrigsssshqgyqnvlaayalsqvpelqpdsptgvqdwatsfdrqlef
lqwlqsaeggiaggatnswkgsydtpptglsqfygmyydwqpvwndppsnnwfgfqvwnm
ervaqlyyvtgdaraeaildkwvpwaiqhtdvdadnggqnfqvpsdlewsgqpdtwtgty
tgnpnlhvqvvsysqdvgvtaalaktlmyyakrsgdttalataeglldallahrdsigia
tpeqpswdrlddpwdgseglyvppgwsgtmpngdriepgatflsirsfykndplwpqvea
hlndpqnvpapiverhrfwaqveiatafaahdelfg

SCOPe Domain Coordinates for d4jjja_:

Click to download the PDB-style file with coordinates for d4jjja_.
(The format of our PDB-style files is described here.)

Timeline for d4jjja_: