Lineage for d4jfna_ (4jfn A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2608706Fold d.170: SRCR-like [56486] (2 superfamilies)
    unusual fold; disulfide-rich; core: beta-x-alpha-beta-loop-beta
  4. 2608745Superfamily d.170.2: A heparin-binding domain [56491] (1 family) (S)
    automatically mapped to Pfam PF02177
  5. 2608746Family d.170.2.1: A heparin-binding domain [56492] (2 proteins)
  6. 2608750Protein automated matches [257780] (1 species)
    not a true protein
  7. 2608751Species Human (Homo sapiens) [TaxId:9606] [257781] (2 PDB entries)
  8. 2608753Domain d4jfna_: 4jfn A: [257782]
    automated match to d1mwpa_
    complexed with cu, gol

Details for d4jfna_

PDB Entry: 4jfn (more details), 1.75 Å

PDB Description: Crystal structure of the N-terminal, growth factor-like domain of the amyloid precursor protein bound to copper
PDB Compounds: (A:) amyloid beta a4 protein

SCOPe Domain Sequences for d4jfna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jfna_ d.170.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dgnagllaepqiamfcgrlnmhmnvqngkwdsdpsgtktcidtkegilqycqevypelqi
tnvveanqpvtiqnwckrgrkqckthphfvipyrclvgefv

SCOPe Domain Coordinates for d4jfna_:

Click to download the PDB-style file with coordinates for d4jfna_.
(The format of our PDB-style files is described here.)

Timeline for d4jfna_: