Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.170: SRCR-like [56486] (2 superfamilies) unusual fold; disulfide-rich; core: beta-x-alpha-beta-loop-beta |
Superfamily d.170.2: A heparin-binding domain [56491] (1 family) automatically mapped to Pfam PF02177 |
Family d.170.2.1: A heparin-binding domain [56492] (2 proteins) |
Protein automated matches [257780] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [257781] (2 PDB entries) |
Domain d4jfna_: 4jfn A: [257782] automated match to d1mwpa_ complexed with cu, gol |
PDB Entry: 4jfn (more details), 1.75 Å
SCOPe Domain Sequences for d4jfna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jfna_ d.170.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dgnagllaepqiamfcgrlnmhmnvqngkwdsdpsgtktcidtkegilqycqevypelqi tnvveanqpvtiqnwckrgrkqckthphfvipyrclvgefv
Timeline for d4jfna_: