Class b: All beta proteins [48724] (176 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (24 species) not a true protein |
Species Influenza a virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId:757360] [256747] (1 PDB entry) |
Domain d4cyzc_: 4cyz C: [257770] Other proteins in same PDB: d4cyzb_, d4cyzd_, d4cyzf_ automated match to d4dj6a_ complexed with edo, nag |
PDB Entry: 4cyz (more details), 2.4 Å
SCOPe Domain Sequences for d4cyzc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cyzc_ b.19.1.2 (C:) automated matches {Influenza a virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId: 757360]} dkiclghhavangtivktltneqeevtnatetvestsldrlcmkgrshkdlgnchpigml igtpacdlhltgtwdtlierenaiaycypgatvneealrqkimesggiskistgftygss insagttkacmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhpss tqekndlygtqslsisvgsstyqsnfvpvvgarpqvngqsgridfhwtlvqpgdnitfsh nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk yvnkkslmlatgmrnvpe
Timeline for d4cyzc_: