Class b: All beta proteins [48724] (176 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (23 species) not a true protein |
Species Influenza a virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId:757360] [256744] (2 PDB entries) |
Domain d4cywc_: 4cyw C: [257769] Other proteins in same PDB: d4cywb_, d4cywd_, d4cywf_ automated match to d4f23a1 complexed with nag |
PDB Entry: 4cyw (more details), 2.6 Å
SCOPe Domain Sequences for d4cywc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cywc_ b.19.1.0 (C:) automated matches {Influenza a virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId: 757360]} ldkiclghhavangtivktltneqeevtnatetvestsldrlcmkgrshkdlgnchpigm ligtpacdlhltgtwdtlierenaiaycypgatvneealrqkimesggiskistgftygs sinsagttkacmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhps stqekndlygtqslsisvgsstyqsnfvpvvgarpqvngqsgridfhwtlvqpgdnitfs hnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcp kyvnkkslmlatgmrnvpe
Timeline for d4cywc_: